TESAMORELIN 10 mg
Product Overview
Research Context
Tesamorelin is a synthetic peptide analog of growth hormone–releasing hormone (GHRH). In laboratory research environments, Tesamorelin has been studied for its interactions with endocrine signaling pathways that regulate growth hormone release and metabolic communication within cells.
Researchers frequently examine Tesamorelin in experimental models exploring hormonal signaling regulation, peptide-mediated endocrine communication, and metabolic pathway interactions. Because it mimics the activity of naturally occurring GHRH signaling peptides, Tesamorelin provides a useful tool for studying how peptide hormones influence cellular communication and growth factor regulation.
Laboratory investigations involving Tesamorelin often focus on areas such as:
• Peptide regulation of endocrine signaling pathways
• Growth hormone releasing hormone (GHRH) receptor activity
• Hormone-mediated metabolic signaling networks
• Cellular communication within endocrine systems
• Peptide interactions with pituitary signaling mechanisms
Due to its role as a GHRH analog, Tesamorelin continues to be a compound of interest for researchers studying how peptide hormones coordinate complex endocrine signaling and metabolic regulation at the cellular level.
This material is supplied strictly for controlled laboratory research applications and should be handled only by qualified professionals in appropriate research environments.
Research Highlights
Tesamorelin has been explored in a variety of experimental models examining peptide-mediated endocrine signaling and hormone regulation pathways. Research interest often centers around how synthetic peptide analogs interact with receptors involved in growth hormone signaling and metabolic communication.
Key areas of laboratory investigation have included:
• GHRH receptor signaling – studies examining how peptide analogs interact with receptors responsible for growth hormone releasing hormone activity.
• Endocrine communication pathways – research exploring how signaling peptides influence interactions between endocrine glands and cellular hormone signaling networks.
• Metabolic signaling mechanisms – investigations into peptide influence on metabolic regulatory pathways and hormone-mediated cellular responses.
• Pituitary signaling models – laboratory research examining peptide interactions with pituitary hormone signaling processes.
• Synthetic peptide analog stability – studies evaluating how modified peptides mimic or influence natural hormone signaling systems.
Scientific Research Information
Peptides and research compounds supplied by Superior Chains Research Labs are intended strictly for laboratory and analytical research applications. Many compounds offered within this catalog are studied in experimental environments investigating molecular signaling pathways, receptor interactions, cellular communication mechanisms, and biochemical regulatory systems.
Researchers frequently utilize synthetic peptides and laboratory compounds when examining:
• peptide–receptor signaling pathways
• intracellular communication mechanisms
• metabolic and regulatory signaling networks
• enzyme activity and biochemical pathway interactions
• cellular stability and molecular signaling systems
Because peptide molecules function as biological messengers within complex cellular systems, they remain an important focus of modern biochemical and molecular research. Laboratory-grade peptides allow researchers to study how these signaling molecules interact with receptor systems and participate in regulatory communication pathways.
All products distributed by Superior Chains Research Labs are supplied exclusively for controlled laboratory research purposes and must be handled by qualified professionals within appropriate research environments.
TESAMORELIN is a synthetic research peptide supplied for laboratory use only.
This product is intended for qualified researchers and controlled laboratory settings.
It is not approved for human or veterinary use, medical applications, or diagnostic purposes.
Specifications
| Product Name | TESAMORELIN |
| Chemical Name / Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL |
| CAS Number | 218949-48-5 |
| Molecular Formula | C221H366N72O67S |
| Molecular Weight | 5136 Â g/mol |
| Purity | ≥ 99% (HPLC) |
| Form | Lyophilized powder |
| Quantity | 10 mg |
Storage & Stability
- Recommended storage: -20°C / -4°F protected from light and moisture.
- Short-term storage after reconstitution: 2–8°C / 35-46°F for up to 8 weeks.
- Avoid repeated freeze–thaw cycles.
- Do not freeze after reconstitution.
Refer to the Certificate of Analysis (COA) for lot-specific stability and handling guidance.
Documentation
Handling & Safety
- Use appropriate personal protective equipment (PPE) when handling.
- Handle in a controlled laboratory environment.
- Dispose of unused material in accordance with local regulations and institutional protocols.









Reviews
There are no reviews yet.